SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007904 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007904
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-62
Family Alanine racemase-like, N-terminal domain 0.000000135
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.98e-34
Family Eukaryotic ODC-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007904   Gene: ENSSTOG00000008823   Transcript: ENSSTOT00000008819
Sequence length 448
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:40802041:40830318:1 gene:ENSSTOG00000008823 transcript:ENSSTOT00000008819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSTPAVLEILAALGIGFACSSKNEMALLQELGVSPENIIYISPCKQVSQI
KYAAKIGVNIMTCDSEIELKKIARNHPNAKVLLHIATEDTIGGEEGSMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVGKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVENCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDTMMKNFFFVPSCIQLSQEDSFSTEA
Download sequence
Identical sequences I3MCC6
ENSSTOP00000007904 NP_001278561.1.77405 NP_001288718.1.77405 XP_015341837.1.40921 XP_015341838.1.40921 ENSSTOP00000007904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]