SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008016 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008016
Domain Number 1 Region: 250-353
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-150
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000115
Family Heme-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008016   Gene: ENSSTOG00000008934   Transcript: ENSSTOT00000008943
Sequence length 816
Comment pep:known_by_projection scaffold:spetri2:JH393471.1:95944:176377:-1 gene:ENSSTOG00000008934 transcript:ENSSTOT00000008943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKMLSSHMLVTESPSPEFLKSDNDLEFYCHLLRGSLDPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNALSRPCRVSLGKEVCFIATVRLATPQFLKA
MEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLAR
CHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRV
ERRQELALEDPPPEALHPSAMKDKGSSHDPQQHFNALDVGAAGLNASPSPSVSSRSSHKS
SHTAMSEPASTPTKLMAEASTTALPRSATLPQELLVPGLGQAATMPAPLPSPPSCDLTQQ
LLPQTILQSPPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQ
DSNIQMFLQQPAVSLSFSSAQRPEAQPQLQQRPAAVSQPQLVASQQLSGQMASTQVTNQH
LLRESSVISTQGPKVIRSSQVMQGSSRAVSSLTPQFSSPAAPGLSLTAPAAASQDASQCQ
PSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQAQAVFPHPDSRPTS
SSTSTPVLLMGQAALAHSFPASQPAPLQAQPQPPHYLQASTSLHSEQPDSLLLSTYAQQP
GALGYTPPPPAQPQPARAPRRVSRLSESSGLQPPPR
Download sequence
Identical sequences ENSSTOP00000008016 ENSSTOP00000008016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]