SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008025 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008025
Domain Number 1 Region: 357-708
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.92e-140
Family Transferrin 0.000000000047
Further Details:      
 
Domain Number 2 Region: 24-352
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.54e-125
Family Transferrin 0.0000000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008025   Gene: ENSSTOG00000008950   Transcript: ENSSTOT00000008954
Sequence length 709
Comment pep:known_by_projection scaffold:spetri2:JH393406.1:344472:373777:-1 gene:ENSSTOG00000008950 transcript:ENSSTOT00000008954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLFLAPLFLGALGVCLAASRKGSVRWCTTSPPEATKCSQLQRNMRRVRAPPLSCVRKN
SYLQCIQAIASNKADAVTLDGGLVFEAGQDPYKLRPVVAEVYGTEAKPRTYYYAVAIVKK
GTGFQLNQLQGRRSCHTGLGRTAGWNVPIGILRPFLNWVGPPEPLEAAVARFFSGSCVPG
ADGVRFPNLCSLCAGTGENKCAASSQEPYFGYSGALKCLRDGAGDVAFAKESTVFEDLPD
EAERDKYELLCPDNTRKPVDQYKECHLARVPSHAVVARSVDGKEDLIWEFLRQAQENFGK
NKSPGFQLFGSPKGQKDLLFKDTALGFLRVPPKIDAGLYLGYGYFTAIKNLREREADTAA
RQRQVVWCAVGTDEQRKCTTWSDVSGRTVTCASAPTTEDCISLILKGEADAMSLDGGFIY
TAGKCGLVPVLAENHQSQENKDSDCVNRQPEGYLAVAAVRKSDTDITWNSLKGRKSCHTA
VGRTAGWNIPMGLLFNQTGSCKFDEFFSQSCAPGSDPASNLCALCIGDEKGEHKCMPNSN
ERYHSYAGAFRCLAEKAGDVAFLKDVTVLQNTDGKNPEAWAKDLKLDDFELLCLDGTRKP
VTEARSCHLAVAPNHAVVSRKDKAAHLEQVLLDQQVKFGRKGSRCPGEFCLFKSDTKNLL
FNDNTECLAKLHGRTTSEKYLGQQYITAVANLQQCSTSELLDACAFLRK
Download sequence
Identical sequences I3MCM8
ENSSTOP00000008025 ENSSTOP00000008025 XP_005332973.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]