SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008032 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008032
Domain Number 1 Region: 24-506
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-184
Family ALDH-like 0.00000000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008032   Gene: ENSSTOG00000008968   Transcript: ENSSTOT00000008962
Sequence length 512
Comment pep:known_by_projection scaffold:spetri2:JH393293.1:2932695:2967228:-1 gene:ENSSTOG00000008968 transcript:ENSSTOT00000008962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGALENGQLDRKPPALPRPIHNLEVKFTKIFINNDWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGRLLHQLADLMERDRAILATLETM
DTGKPFLHAFFIDLEGCIKTFRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTVVLKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDAKTEQGPQIDQK
QFDKILELIESGKNEGAKLECGGSAMEDRGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKNIEEVIKRANSTDYGLTAAIFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLDDKNP
Download sequence
Identical sequences A0A287CVR7
ENSSTOP00000008032 XP_005320140.1.77405 ENSSTOP00000008032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]