SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008066 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008066
Domain Number 1 Region: 129-278
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.06e-44
Family Mannose 6-phosphate receptor domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 282-426
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-42
Family Mannose 6-phosphate receptor domain 0.000000354
Further Details:      
 
Domain Number 3 Region: 586-721
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-38
Family Mannose 6-phosphate receptor domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1474-1605
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.29e-37
Family Mannose 6-phosphate receptor domain 0.000000156
Further Details:      
 
Domain Number 5 Region: 1325-1465
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.15e-36
Family Mannose 6-phosphate receptor domain 0.00066
Further Details:      
 
Domain Number 6 Region: 718-883
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.26e-33
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1035-1177
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-33
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 8 Region: 1182-1321
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-33
Family Mannose 6-phosphate receptor domain 0.00016
Further Details:      
 
Domain Number 9 Region: 440-577
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-31
Family Mannose 6-phosphate receptor domain 0.0023
Further Details:      
 
Domain Number 10 Region: 1610-1755
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2091-2238
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 10-126
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-29
Family Mannose 6-phosphate receptor domain 0.00000157
Further Details:      
 
Domain Number 13 Region: 1948-2084
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-28
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 14 Region: 893-1036
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-23
Family Mannose 6-phosphate receptor domain 0.0032
Further Details:      
 
Domain Number 15 Region: 1762-1855,1904-1947
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-21
Family Mannose 6-phosphate receptor domain 0.0039
Further Details:      
 
Domain Number 16 Region: 1854-1902
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-16
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008066   Gene: ENSSTOG00000008960   Transcript: ENSSTOT00000009002
Sequence length 2452
Comment pep:known_by_projection scaffold:spetri2:JH393299.1:11446491:11524401:1 gene:ENSSTOG00000008960 transcript:ENSSTOT00000009002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSCSFFLSSFIWEAVDTQNSILYKISICGNVDIGQCGPSSAVCMYDLKTGIYRSVGDSL
LKSATRSLLEFNTTHSCGQQGTGHRIQSSITFLCGKTLGTPEFVTATECVHYFEWRTTAA
CKKDIFKANKEVPCYVFDRELKKHDLNPLIKISGGYLVDDSDPDTSLFINVCRDIDSLRN
SSPQLRACPAGTAACLLRGDQAFDVGQPKEGLKRVSEDRLVLSYVKEGPGKPDFCDGHSP
AVTITFMCPSERREGTIPKLTAKSNCRYEIEWITEYACHRDYLESKNCSLSSAQHDIAVD
LRPLAQPGGSPYASDGDEYTFYMDVCGEAEIPVCNNKGAAVCQVKKKDTTQVKAAGRHQS
QTLRYSDGDLTLIYFGGDECSSGFQRMSVINFECNETAGNDGKGEPVFTGEVDCTYFFTW
DTRYACVKEKEDLLCGASDGKKRYDLSALARHSESEQNWEAVVGSQTETEKKHFFINVCH
RVLPKGKASSCPEDAAVCAVDKTGSKNLGKFVSSPTKEKGNIQLSYSDGDDCGGDKKIAT
NITLVCKPGDLESGPVLRASRDDGCFYEFEWHTAAACVLSRTEGENCTVFDSQAGFSFNL
SPLTKKNGAYKVETAEYDFYINVCGAVSQDSCQPDAGACQVAKSDKKSWNLGLSNAKLSY
YDGMIQLNYRDGTPYNNEKRTPRATLITFLCDREAGVGFPEYQEEDSSTYNFRWYTSYAC
PEEPLECVVTDPSTLEQYDLSSLAKSEGDHGGNWYAMDNSGEHVTWRKYYINVCRPLNPV
PGCDRYTSACQMKYEKDQGSFTEVVSVSNLGVAKAGPVVEESGSLLLEYVNGSACTTSDG
QLTTYSTRIHLICSRGSLNTHPIFSLNWGCVVSFLWNTEAACPVQTMTDTDQACSIRDPN
TGFVFDLNPLNSSQGYVVSGIGKTFVFNVCGTMPLCGTFGGKPASGCEAATQTEELKNLR
PERPVGFEKSLQLSTEGFLTLTYKGAPPADRGTVFIIRFLCNADVYPGTPRFLHQDIDST
RGIRSTFFEFETALACVPSPVDCQVTDSAGNEYDLSALSTVRKPWTAVDTSAGGRKRTFY
LSVCNPLPYVPGCHGSAVGSCLVSEDNSWNLGVVQISPQMAANGSLSIVYVNGDKCGTQR
FSTRITFECAQTSGSPTFQLLDDCEYVFVWRTVEACPVVRAEGDNCQVKDPRHGNLYDLR
PLGLQDTVVSAGEYNYHFRVCGKLSSDVCPTSDTSKVVASCQEKQGPEGFHKVAGLLTQK
LTYENGLLKMNYTGGDTCHQVYQRSTTIFFYCDRTTQKPVFLRETSDCSYLFEWRTQHAC
PPFSVIECSFKDGAGNSYDLSPLSRYSDNWEAVTRTGATEHYLINVCKSLAPQAGTEPCP
PEAAVCLLDGSKPVNLGRVRDGPQWRDGVIVLKYTDGDLCPDKIRKKSATIRFTCSESQV
NSRPLFISAVEECEYTFSWPTAAACPVRSSVHDDCQVTNPSTGHLFDLSSLSGRTGFTAA
YSEKGLVYMSICGDNENCAPGVGACFGQTRISVGKASKKLTYVDQVLQLVYEDGSPCPSK
SGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSII
DLSPLIHRTGGYEAYDESEDDTSDTNPDFYINICQPLNPMHGVPCPAGSAVCKVPVSGPP
IDIGRVTGPPILNPVANEIYLNFESSTPCLADRHFNYTSLIAFHCKRGVSMGTPKLIRTS
ECDFVFEWETPIVCPDEVKTEGCALTDEQLLYSFNLSSLSRSTFKVTRGSRTYSVGVCTA
AAGPEQGGCKDGGVCLLSGSKGASFGRLASMQLDYRHQDEAVILSYVNGDTCPPETEAGD
PCVFPFTFNRKSYEECVLEGRARLWCSTTADYDRDREWGFCRQTNSHRTSAIIFKCDEDE
DIGRPQVFSEVRGCEVTFEWKTKVVCPPRKMECKFVQKHKTYDLRLLSSLTGSWFFVHEG
ASYFINLCQRIYKGPLDCSERASICKKSASGQVQVLGLVHTQRLDVIDDKVVVTYSKGYR
CGENKTASSVIELTCAKTVGRPAFKRFDIDSCTYYFRWDSRAACAVRPQEVQMVNGTLTN
PVNGKSFSLGDIYFKLFSASGDMRTNGDNYLYEIQLSSITSSTNPACSGANICQVKPNDE
HFSRKVGTSDRTKYYVQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSH
ETADCQYLFSWYTSAVCPLGVGFDGESAGPDGQGHKGLSERSQAVGAVLSLLLVALIGCL
LALLLHKKERRETVINKLSNCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPAPRL
GREGQENGHITTKSVKAEALTSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSQPARNAQ
RRALREREDDRVGLVQGEKARKGKPRPGQQKTGTSAMLASFHDDSDEDLLHI
Download sequence
Identical sequences I3MCR1
XP_021579624.1.77405 ENSSTOP00000008066 ENSSTOP00000008066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]