SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008176 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008176
Domain Number 1 Region: 173-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-33
Family Phosphate binding protein-like 0.00000348
Further Details:      
 
Domain Number 2 Region: 4-163
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.35e-20
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008176   Gene: ENSSTOG00000009114   Transcript: ENSSTOT00000009120
Sequence length 380
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:6944732:7322386:-1 gene:ENSSTOG00000009114 transcript:ENSSTOT00000009120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKY
TSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQG
MTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI
VVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDP
ETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVF
SFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGI
FNSLWFSLGAFMQQGCDISP
Download sequence
Identical sequences ENSSTOP00000008176 ENSSTOP00000008176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]