SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008224 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008224
Domain Number 1 Region: 361-471,582-730
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.27e-51
Family Phosphate binding protein-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 1-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.88e-24
Family L-arabinose binding protein-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000008224
Domain Number - Region: 494-575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0157
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008224   Gene: ENSSTOG00000009154   Transcript: ENSSTOT00000009171
Sequence length 926
Comment pep:known_by_projection scaffold:spetri2:JH393497.1:723879:1384761:1 gene:ENSSTOG00000009154 transcript:ENSSTOT00000009171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDD
YTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVE
NNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFISEVVETNLVAFDCHWIII
NEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNME
ISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGL
TGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGV
VLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQE
DGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC
LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMASTTLYNSMWFVYGSFVQQGG
EVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTDIPYGT
VLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVW
DAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDVFSQRILELQQSGDMDILK
HKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAAGIVLSCFIAMLETWWSKRKGS
RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISD
FRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGNVPEHRTGPFRHRAPNGGFFRSPIKT
MSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences ENSSTOP00000008224 ENSSTOP00000008224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]