SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008406 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008406
Domain Number 1 Region: 354-571
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.14e-48
Family Galactose oxidase, central domain 0.016
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily POZ domain 2.69e-34
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 3 Region: 263-341
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000196
Family Galactose oxidase, central domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008406   Gene: ENSSTOG00000009381   Transcript: ENSSTOT00000009369
Sequence length 571
Comment pep:known_by_projection scaffold:spetri2:JH393393.1:4299195:4333790:1 gene:ENSSTOG00000009381 transcript:ENSSTOT00000009369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHTSPTYMLANLAHLHSEQLLQGLNLLRQHHELCDIILRVGDVKIYAHKVVLASISPYF
KAMFTGNLSEKENSEVEFQSIDETALQAIVEYAYTGTVFISQDTVESLLPAANLLQIKLV
LKECCAFLESQLDPGNCIGISRFAETYGCHDLYLAATKYICQNFEAVCQTEEFFELTHAD
LDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSVKFLTRLYEA
NHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRCAPKVLCAVGGKSGLFACLDS
VEMYFPQSDSWIGLAPLNIPRYEFGICVLDQKVYVIGGIETNVRPGVTIRKHENSVECWN
PDTNTWTSLERMNESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMT
TTRSCFAAAVLDGMIYAIGGYGPAHMNSVERYDPSKDSWEMVASMADKRIHFGVGVMLGF
IFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGHSGSSYL
NTVQKYDPISDTWLDSAGMIYCRCNFGLTAL
Download sequence
Identical sequences I3MDF2
ENSSTOP00000008406 XP_005331811.1.77405 XP_015346719.1.40921 ENSSTOP00000008406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]