SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008602 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008602
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily DNA clamp 1.1e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000008602
Domain Number - Region: 37-98
Classification Level Classification E-value
Superfamily DNA clamp 0.0246
Family DNA polymerase processivity factor 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008602   Gene: ENSSTOG00000009593   Transcript: ENSSTOT00000009589
Sequence length 279
Comment pep:known_by_projection scaffold:spetri2:JH393328.1:6621119:6626173:1 gene:ENSSTOG00000009593 transcript:ENSSTOT00000009589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQIQDENENSLVASLDNVRNLSTILKAIHFKDFATCFATKNGIKVTVENAKCVQA
NAFIQAEIFQEFVVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGHPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITM
SPNKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
Download sequence
Identical sequences I3MDU2
ENSSTOP00000008602 ENSSTOP00000008602 XP_005325700.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]