SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008632 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008632
Domain Number 1 Region: 399-428,465-569,691-806
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.76e-56
Family Phosphate binding protein-like 0.0000000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008632   Gene: ENSSTOG00000009611   Transcript: ENSSTOT00000009622
Sequence length 1171
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:197737:208415:-1 gene:ENSSTOG00000009611 transcript:ENSSTOT00000009622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHVLVSPQDPLVDMGGALGPALLLTSLLGAWAGSGLGQGQQAMTVAVVFGSSEPPQAQAQ
ARIRLTPQNFLDLPLEIQPLTVGVNSTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVA
QLLDFVSSQTHAPILSISGGSTVVLTPKVLSDLFMGLGTRAESGVGRGKVLEAGTGWGRQ
GGMGGGEPMLLSQMRCPRSFLGRTWKHTCICRPHRGKRGPGHRGWHLAHCIGPPKVLREE
ADLICLRFILWRILSLHMSLMNPHLPLAHLGQPTPDSQVWGKTGLLGLWXLSLRQKVRDG
VAILALGAHSYLRHHGALPAPVGDCRSHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGY
LVQPTMVVIALNRHRLWEMVGRWDHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERP
FVIVESPDPGTGGCVPNTVPCRRQSNHTFSGGCSSGDAAPYTKLCCKGFCIDILKKLAKV
VKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVE
TGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTK
GKKPGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLA
AFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQ
RSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSH
WKRAIDLALLQFLGDGETQKLETVWLSGICHNEKNEVMSSKLDIDNMAGVFYMLLVAMGL
ALLVFAWEHLVYWKLRHSVPNTSQLDFLLAFSRGIYSCFSGVQSLASPARPPSPDLTAGS
AQASVLKMLQAARDMVTTAGVSSSLDRATRTIESWGSSRHARHLSASERCALSERPLSPA
HCHYSSFPRADRSGRPFLPLFPEPPEPDDLPLLGPEQLAQREALLRAAWARNPRPRHASL
PSSVAEAFTRPGLLPARYTGHACSCPTSRPACRHLAQAQSMRLPSYPEACRQGVPAGVLA
WQPRQHVCLHAHAHLPFCWGAVCPHFPPCASHGPWLPGSWGPPVNRGRTLGLSTDYRDSG
VLEEVSRGACGTKGSRRPCTWRRISSLESEV
Download sequence
Identical sequences ENSSTOP00000008632 ENSSTOP00000008632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]