SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008651 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008651
Domain Number 1 Region: 141-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-53
Family C-terminal domain of adrenodoxin reductase-like 0.0000000069
Further Details:      
 
Domain Number 2 Region: 38-201
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.89e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000445
Further Details:      
 
Domain Number 3 Region: 342-491
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000377
Family N-terminal domain of adrenodoxin reductase-like 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008651   Gene: ENSSTOG00000009639   Transcript: ENSSTOT00000009642
Sequence length 492
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:215475:223672:-1 gene:ENSSTOG00000009639 transcript:ENSSTOT00000009642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWHWLGWPRIRPPSASNSTNSGFYRHFSAQKNPQICVVGSGPAGFYTAQHLLK
HHTQAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFRGNVVVGKDVT
VPELQGAYHAVVLSYGAEDHQRLEIPGEELPGVCSARAFVGWYNGLPENRELAPDLSCDT
AVILGQGNVALDVARILLTPHEHLEKTDITEAALGVLRQSQVKTVWIVGRRGPLQVAFTI
KELREMIHLPGTRPILDPADFLGLQDRIKEVPRPRKRLMELLLQTATEKPGAGAARQALA
TRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGVGEATQAVPTGDTEDLPCGLVLSS
VGYKSRPIDPSVPFDSKLGIIPNVEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTSQ
MLLQDLKAGLLPSGPRPGFAAIQALLSSRGVRPVSFSDWEKLDAEEVSRGQGAGKPREKL
VDPHEMLRLLGH
Download sequence
Identical sequences I3MDY2
ENSSTOP00000008651 ENSSTOP00000008651 XP_005332587.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]