SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008816 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008816
Domain Number 1 Region: 244-427
Classification Level Classification E-value
Superfamily vWA-like 0.000000000467
Family Trunk domain of Sec23/24 0.056
Further Details:      
 
Domain Number 2 Region: 732-840
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008816   Gene: ENSSTOG00000009821   Transcript: ENSSTOT00000009830
Sequence length 1292
Comment pep:known_by_projection scaffold:spetri2:JH393502.1:1952975:2155238:1 gene:ENSSTOG00000009821 transcript:ENSSTOT00000009830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREPEEEETVGTAALALRCPGSPGWAGAGAGATRPPLWLLCLLSCWLLGAVANADFSIL
DEAQVLASQMRRLAAEELGVVTMQRIFNSFLYTEKISNGESEVQQLAKKIREKFNRYLDV
VNRNKQVVEASYTAHLTSPLTAIQDCCTLPPSMMEFDGNFNTNVSRTISCDRLSTTVNSR
AFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGTYEHRSRPIYVSTV
RPQSKHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLDQCY
KTFLSPATSETKRKMSTFVSSVKASDSPTQHASGFQKAFQLIRSTNNNTKFQANTDLVVI
YLSAGITSKDSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAE
QNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMG
DGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSL
TRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETG
KEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACL
HFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVR
NEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLH
AVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLM
DLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHP
NFVKKNLCNSFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNET
CDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEP
VTYTAIDPGLQDSLHQCVNSRCSQRMESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKE
CFGGIVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIH
RRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERR
RRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHEEDLDLDTPPQTAALLS
HKFHHYRSHHPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences I3MEB1
XP_005337776.1.77405 ENSSTOP00000008816 ENSSTOP00000008816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]