SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008882 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008882
Domain Number 1 Region: 92-167
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000282
Family VWC domain 0.022
Further Details:      
 
Domain Number 2 Region: 44-98
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000115
Family VWC domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000008882
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily FnI-like domain 0.000837
Family VWC domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008882   Gene: ENSSTOG00000009889   Transcript: ENSSTOT00000009903
Sequence length 277
Comment pep:known_by_projection scaffold:spetri2:JH393288.1:9765115:9940472:1 gene:ENSSTOG00000009889 transcript:ENSSTOT00000009903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRTQCVREVCPILSCPQHLSHTPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFL
YDNCTACTCKDSTVVCKKKCSPPGSCDKAKEACCEECLLRVPPEDIKVCKFGNKIFRDGE
MWSSVNCTICACVKGKTECRKKQCIPISSCPQGKILNRKGCCPICTEKPGVCTVFGDPHY
NTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVELVLGESTISL
QQHLTVRWNGSRIALPCHAPHFHIDLDGYLLKVTTRA
Download sequence
Identical sequences ENSSTOP00000008882 ENSSTOP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]