SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008960 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008960
Domain Number 1 Region: 2195-2387,2440-2623,2659-2714
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.78e-110
Family DNA polymerase I 0.00000101
Further Details:      
 
Domain Number 2 Region: 227-395,428-483,535-623
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.41e-44
Family Tandem AAA-ATPase domain 0.00039
Further Details:      
 
Domain Number 3 Region: 787-957
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.54e-42
Family Achaeal helicase C-terminal domain 0.0029
Further Details:      
 
Domain Number 4 Region: 2026-2160
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000797
Family DnaQ-like 3'-5' exonuclease 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000008960
Domain Number - Region: 655-743
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0087
Family RecQ helicase DNA-binding domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008960   Gene: ENSSTOG00000009954   Transcript: ENSSTOT00000009989
Sequence length 2718
Comment pep:known_by_projection scaffold:spetri2:JH393346.1:7904981:8004837:-1 gene:ENSSTOG00000009954 transcript:ENSSTOT00000009989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGHHFAFRTHLLPPCYRTEHRFLNRLLAQRGPSSTFTAPSLQRSHMEGVCSPAIPNSGS
HIPHCMMAKIEIVYRSYIGRKRKLCSIRNPRRWREDDSYICHQAGVLPYGRALGGCLVLN
SPGDSAMNLLHRSGKRRRSDSDSFSGSGGDSGFSPQLLSGPVLSPPPGLGRSLKAAGAGV
CKQTDLDDQVDKLLLANWGLPKAVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAP
TSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTS
PTGHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTK
ICYITQKSASSQADLASPLSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESV
KIGNSIYDSSMKLVREFQPMLQVKGDEDHVVSLCYEIVRDNHSVLLFCPSKKWCEKLADI
IAREFYNLHHQAEDQGLVKPSEFPPVVLEQKALLEVMDQLKRSPSGLDFVLQNTVPWGVA
FHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPIFSGRPLDILTY
KQMVGRAGRKGVDTMGESILVCKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTASMIRA
ILEIIVGGVASTSKDMQMYASCTFLAASIKEGRQGIQRNQDSVQLGAIEACVMWLLENEF
IQITEDSDGTEGKVYRPTHLGSATLSSSLSPTDTLDIFADLQRAMKGFVLENDLHIVYLV
TPMFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVEARTEKQHRQMA
IHKRFFTSLVLLDLISEIPLKEINQKYGCNRGQIQSLQQSAAIYAGMITVFSNRLGWHNM
ELLLSQFQKRLTFGIQRELCDLIRVSLLNAQRARFLYAAGFLSVADLARADVAEVEVALK
NAVPFKSARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEAKMILHQDLVEM
GVQWDPHSPLSSGTNSLSRSESEQEHTLITQTTSSHKRLTSKNKSNIRFSDSYIKHSPDI
VQDLDKTREHTSSFHCNSQDGNQEHQRYSISRARKRASLGIHKKRLRTSLNKGKSGTRKV
VQTFSLEKTKKAALNFSSEEMNTGFQSWNNRKHQKQSTDGSQVKDSGQRGIDLKGQTMFS
PDVCEEPFTVDEKNIEFRSPQPFAKNVPFYTKGNYNKTSLLLQTEQSCLKKRTTTNDILE
KCSVIGSQSKTMTCQATSVVSKNGRGSAVVETEKINTVLIQNDLKNQNVSVVYHDSHPVN
QGLEKQHDKPTDTNIKQKEIIQRKMPCEVVSSYMHKEPVVTAITCESIKFNSKENKPNHF
QALGDNVHRSGVTPGIFQSMRTFGKSGGQHENFLNSSSRKEKTNAYVTNKTENNCVSDLG
LVCDFEDSFYLDTQSEKIIQQMATENAKPGAKDTNLAAGTIQKSVEKQDLNPFHSESHIS
GEQHSPGVTNQERLDLKTTETVKQSTEQEVDSLTPESLVFHSPILLEENSPCFKGNELSV
TDSQLNSFLQGYQTQEMVKPVTPVVPWKSSPTDTEGECLPGPEISLNMSDSLLFDSFSED
FLVKEQPLDVQMKEPPPPEITSNHFSDSVCIQEDPVKISNVNEHQGILQQLTCVNDESIM
FSEVDSVQMVEALDNVDIFPVQEKCNSVVSLKALGRSDSVIVNNGHLHGEVIGGDEDDEK
ASKSRLTGTRQNNSFGWSGASIDLSPELQRILDKVSSPLENEKPKLTTINLSSLKGKNTE
LHERKEVILNLETNQVQAISIFPNNEVKSKIEALTSSAKHGETSFHLPCKEGLIADDNGL
IPPTPIPASASKLVFPEMLGASVKVQKTSNVLQPGEDCTFGSTLDNKKQDLMLENRNNFQ
EDNLVRDTSFSLQLSQDGLQLTPASCSSESLAIIDVASDQTLFQTFIKEWQCKKRFSISL
ACEKIRSLTSSKTATIGGRFKKVSSLQETPIREDGFPLQGSDDILVVGLAVCWGGRDAYY
VSLQKEQQYSEISASLVPPSLDPGLTVKDRMWHLQSCLQKESDKERSVIIYDFIQIYKIL
LRSCGISLEQSYEDPKVACWLLDPDSKEPTLHSIVTSFLPHELPLLEGLETGQGIQSLGL
NVNTEHSGRYRASIESILTFSSMNQLNSLLQKENLQDIFCKVEMPSQYCLALLELNGIGF
STAECESQKHIMQAKLDAIETQAYQLVGHSFSFTSADDIAEVLFLELKLPPNGEMKSQGS
KKTLGSTRRGHDGGRKLRLGRRFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPL
QREKRLNPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVEESPPSQAPG
KSLLLTGRGQNKKSCVPNPGHQAPMGEKAADRGMPFAVSMRHAFIPFPGGLILAADYSQL
ELRILAHLSQDYRLIHVLNTGADVFRSIAAEWKMMDPQSVGDDLRQQAKQICYGIIYGMG
AKSLGEQMGIKEEDAACYIDSFKSRYTGINHFMKETVKNCKRDGFVQTILGRRRYLPGIK
DNNPYHKAHAERQAINTTVQGSAADIVKIATVNIQKQLETLHSTFKSHGHREGKLQINRT
EIGLLPKRKLQGMFCQNRGGFFILQLHDELLYEVAEEDVVQVAQIVKKEMESAIKLSVKL
KVKVKIGASWGELKDFDI
Download sequence
Identical sequences ENSSTOP00000008960 ENSSTOP00000008960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]