SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008981 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008981
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 22-118
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.31e-33
Family VPS28 N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008981   Gene: ENSSTOG00000010008   Transcript: ENSSTOT00000010011
Sequence length 221
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:7830114:7833060:1 gene:ENSSTOG00000010008 transcript:ENSSTOT00000010011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERVKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences ENSSTOP00000008981 XP_005316090.1.77405 XP_015342121.1.40921 XP_015342123.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]