SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009022 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009022
Domain Number 1 Region: 22-130
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-20
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009022   Gene: ENSSTOG00000010054   Transcript: ENSSTOT00000010059
Sequence length 461
Comment pep:known_by_projection scaffold:spetri2:JH393504.1:1201812:1205246:-1 gene:ENSSTOG00000010054 transcript:ENSSTOT00000010059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQALQGLFLLLLPLLPLRGASAVSLYSPGLSECFQVNGADYRGHQNHTGPRGAGRPCL
FWDQTQQHSYSSSSDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLA
RGRLAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGP
DRNCSWVLGPTSAALELTFRLFELADPRDRLELRDAASGSLLRTFDGSRPPPPGPLRLRA
AVLLLTFSSDARGHAQGFALTYRGLQDAAEDRTPPKGSAQTPAEPPEGANVSCSPRPGAP
QAAMGARVFSTVTAVSVLLLLLLSLLRLLRRRSCVLARGKGPPALGPSRGAGRSWAVWYR
RPQGVALPCPPGDPQAEGPATGYQPLSASSQSSLRSLISAL
Download sequence
Identical sequences I3MER1
ENSSTOP00000009022 ENSSTOP00000009022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]