SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009196 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009196
Domain Number 1 Region: 2-327
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.15e-62
Family ADP-ribosylglycohydrolase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009196   Gene: ENSSTOG00000010251   Transcript: ENSSTOT00000010248
Sequence length 331
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:18581151:18585808:1 gene:ENSSTOG00000010251 transcript:ENSSTOT00000010248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCVGAIYEAQDTVSLPSVLRHVQSLEPEPGSPGSARTETLYYTDDTAMARALVQSLLAKE
AFDEVDMAHRFAQEYKKDPDRGYGAGVITVFKKLLSPKCCDVYEPARAQFNGKGSYGNGG
AMRVAGIPLAYSSVQDVQKFARLSAQLTHASSLGYNGAVLQALAVHLALQGESSSEHFLK
QLLGHMEELEGDAQAVLDARELGMEEHPYSSRLKKVGELLDQDSVTREEVVSELGNGIAA
FESVPTAIYCFLRCMEPDPEIPSAFNNLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMD
QVPESWQQSCEGYEETDVLAQSLHRVFQKSL
Download sequence
Identical sequences ENSSTOP00000009196 ENSSTOP00000009196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]