SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009203 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009203
Domain Number 1 Region: 243-660
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.47e-94
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00046
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.55e-37
Family Ferredoxin domains from multidomain proteins 0.00023
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009203   Gene: ENSSTOG00000010255   Transcript: ENSSTOT00000010256
Sequence length 727
Comment pep:known_by_projection scaffold:spetri2:JH393441.1:2503400:2534665:-1 gene:ENSSTOG00000010255 transcript:ENSSTOT00000010256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRRALVGLSKSPKGYVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYVEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLIEPMVRNEKGLLSYTSWEDALSRVAGMLQSFQGKDVAAVAGGLVDAEALVALKDLLNR
VDSETLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYQYDHLGDSPKILQDIASGSHSFSQVLKDAKKPMVILGSSA
LQRNDGAAILAAVSSIAQTIRVTGGVADDWKVMNILHRVASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
Download sequence
Identical sequences I3MF52
ENSSTOP00000009203 XP_005335160.1.77405 XP_013218238.1.77405 ENSSTOP00000009203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]