SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009235 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009235
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 1.09e-74
Family Thiolase-related 0.0021
Further Details:      
 
Domain Number 2 Region: 2222-2488
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.9e-52
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00000000335
Further Details:      
 
Domain Number 3 Region: 1635-1795
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.75e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.00011
Further Details:      
 
Domain Number 4 Region: 492-617,680-777
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.85e-41
Family FabD-like 0.0042
Further Details:      
 
Domain Number 5 Region: 1879-2068
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.64e-34
Family Tyrosine-dependent oxidoreductases 0.00021
Further Details:      
 
Domain Number 6 Region: 1552-1670
Classification Level Classification E-value
Superfamily GroES-like 8.84e-17
Family Alcohol dehydrogenase-like, N-terminal domain 0.0049
Further Details:      
 
Domain Number 7 Region: 1234-1399
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000344
Family UbiE/COQ5-like 0.047
Further Details:      
 
Domain Number 8 Region: 2122-2186
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000144
Family Acyl-carrier protein (ACP) 0.00012
Further Details:      
 
Domain Number 9 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000772
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009235   Gene: ENSSTOG00000010276   Transcript: ENSSTOT00000010292
Sequence length 2498
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:5592609:5608972:-1 gene:ENSSTOG00000010276 transcript:ENSSTOT00000010292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDNDLQWKAGLYGLPRRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLMALHNAYQAIRSGEC
PAAIVGGINVLLKPNTSVQFMKLGMLSPEGTCKSFDDSGNGYCRSEAVVAVLLTKKSLAR
RVYATILNSGTNTDGYKEQGVTFPSGEAQEQLLHSLYKMAGVAPESLEYIEAHGTGTKVG
DPQELNGIVRALCTSRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
NPNPEIPALRDGRLQVVDQPLPIRGGIVGINSFGFGGSNVHVILQPNTSLPPVPVPHAPL
PRLLQASGRTAEAVQSLLDQGCQHGQDMAFVSMLNSIAPTPVAAMPFRGYAVLGVEDGGR
EVQQVPPGRRPLWFICTGMGAQWCRMGLSLMRLGSFRDSILRSDEAVKPFGLKVSDLLLS
TDEKVFDDIVHAFVSLTAIQIALVDLLTSMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LSAYWRGQCIKEAHLPAGSMAAVGLSWEESKQRCPVGIVPACHNSEDTVTISGPQAAVSE
FVEQLKQEGVFAKEVRTGGFAFHSYYMEAIAPSLLQALKQVIREPKPRSTRWLSTSIPEA
QWQGSLARTFSPEYSVNNLVSPVLFQEALWHVPENAVVLEIAPHALLQAVLKRGLKPSCT
IIPLMKKGHEDNLHFFLTNIGKLHLAGINVNPDALFPPVDFPAPRGTPLISPLIQWDHSQ
TWDVPASEHFPNGSSSTSATVYTIDTSPESPDHYLLDHCIDGRALFPATGYLCLVWRTLA
HRLGLSLEQVPVVFEEVTLHQATILPRTGTVPLEVRLLEASRAFEISQNGSLIVSGKVYQ
WEDPDPKLFEHPEDLGPAEALPTSCLTRADIYKELRLHGYDYGPHFQGILEATLEGNSGK
LLWKDNWVTFLDTVLQMSILSSGHHSLHLPTRITAMHIDPASHLQKVYALQGETQGADVV
VDHHLKTMVAGGVHIMQLHTTAAPRRQHEQLTPILEKFCFSPHLETGCLSQRAELQEEME
LCKGLAQALQARAAQPGLKTSVLGLDGAREPPQQGLSRLLAAACHLQLNGNLQQELGQAL
VQEKALLPEDALLSGLLDSIALKACVDTALENLPSLKMKVVEVLAGDGHLYSRVPALLNT
QPMLQLDYTATDRQAQVLEAAAPLMQQYEVAQGEWDPADPAPSSLGMADLLVCNCAVASL
GDPALALGNMAAALKEGGFLLLHAVLRGHALGDILALLSSEPQHGPSLLSQDEWESLFSK
TALHLVGLKKSFYGSVLFLCRRPAPQDSPIFLPVEDTSFRWVDSLKGILAESSSQPVWLT
ATSCPTSGVVGLVNCLRKEPGGHRIRCILLSNLSSTSPIPKVDLGSTELQKVLQGDLVMN
VYRDGAWGAFRHFPLEQDKPEEQTRHAFVNVLTRGDLSSIRWVCSPLRHVQPSSPGMQLC
TIYYASLNFRDIMLATGKLSPDAIPGKWANRDCMLGMEFSGRDACGQRVMGLVPAEGLAT
SILVSSQFLWEVPSGWTLEEAASVPVVYSTAYYALVVRGRMQHGETVLIHSGSGGVGQAA
IAIALSMGCRVFTTVGSAEKRAYLQARFPQLEDSSFANSRDTSFEQHVLRHTAGRGVDLV
LNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEDAG
ASWQEVAGLLRAGIRDGVVQPLKRTVFSKAHVEQAFRYMAQGKHIGKVLVQVHEEDQEPV
LQRPQPTLMAAVSKTFCPAHKSYVITGGLGGFGLELAQWLVTRGARKLVLTSRSGIRTGF
QAKRVSEWRRQGIQVLVSSSDASSLEGARALVTEATQLGPIGGVFNLAMVLRDAMLENQT
PGLFQDVSKPKYSGTLNLDRVTREACPELDYFVAFSSVSCGRGNAGQSNYGFANSTMERI
CEQRRHEGLPGLAVQWGAIGDVGIVLEAMGTNDTVIGGTLPQRITSCMEVLDLFLSQPHA
VLSSFVLAEKKALARGSAEGQQDLVDAVAHILGIRDLAGVNLDSSLADLGLDSLMGVEVR
QTLEREHDLVLSMREVRQLTLRKLQELSSQTHASPEVASSKSKVVSPARQQAQLNMSTLL
VNPEGPTLTRLNSVQSSERPLFLVHPIEGSTTVFHSLAAKLSVPTYGLQCTRAAPLDSIQ
SLAAYYIDCIKQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQGPAHHSLFLFDGSHTYVV
AYTQSYRAKMTPGCEAEAEAEAMCFFVQQFTDAEHSKVLEALLPLKGLEERVAAAVDLIT
RSHQGLDRQELSFAALSFYHKLXGLESIISIIHSCGRCPSGGAGQPLDSRRPQVCDGKVS
VHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSSTOP00000009235 ENSSTOP00000009235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]