SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009393 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009393
Domain Number 1 Region: 174-431
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-78
Family Eukaryotic proteases 0.00000000639
Further Details:      
 
Domain Number 2 Region: 50-162
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-32
Family Kringle modules 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009393   Gene: ENSSTOG00000010465   Transcript: ENSSTOT00000010466
Sequence length 439
Comment pep:known_by_projection scaffold:spetri2:JH393331.1:5239054:5243385:-1 gene:ENSSTOG00000010465 transcript:ENSSTOT00000010466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLACLLHCALIVSDTEGRHELQASDASNCGCLNGGTCVSYKYFSNIRRCICPKKFQG
EHCEIDTSKTCYEGNGHLYRGKANTDTKGRPCLDWNSPTILQKTYHAHRPDAVHLGLGKH
NYCRNPDNQRRPWCYVQIGLKQFVQECMVQDCSGGKCHSSPRHSFLFPPGQLKFQCGQKA
LRPRFKIIGGEATIIENQPWFAAIYRKHRGGSVTYVCGGSLISPCWVVSATHCFINHQQK
RDYIVYLGQSRLNSNTLGEMKFEVEQLILHEDYSADSLAHHNDIALLKIRSSMGQCAQPS
RSIQTICLPPSHGDAQFDTSCEITGFGKENPTDYLYSKNLKMTVVKLISHQECQQPHYYG
SEVTTNMLCAADPQWETDSCQGDSGGPLICSTQGRLTLTGIVSWGSGCALKNKPGVYTRV
SQFLPWIHTHIGEENGLAL
Download sequence
Identical sequences ENSSTOP00000009393 ENSSTOP00000009393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]