SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009498 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009498
Domain Number 1 Region: 15-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 392-507,626-766
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000009498
Domain Number - Region: 478-621
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00204
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009498   Gene: ENSSTOG00000010578   Transcript: ENSSTOT00000010582
Sequence length 870
Comment pep:known_by_projection scaffold:spetri2:JH393461.1:2970896:3400133:1 gene:ENSSTOG00000010578 transcript:ENSSTOT00000010582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQ
LSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSR
AILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEM
KRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTG
FRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFP
QMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEG
LEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDR
FEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLA
ITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVL
FVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGG
IWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSK
ISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGL
IDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQ
NIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHK
PQAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences A0A1D5QCT3 A0A2J8PUX1 A0A2J8SK73 F8WEZ8 G1SKJ0
ENSOCUP00000003334 ENSSTOP00000009498 ENSSTOP00000009498 ENSNLEP00000017074 ENSP00000358130 9986.ENSOCUP00000003334 ENSOCUP00000003334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]