SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009556 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009556
Domain Number 1 Region: 2-382
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.75e-68
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 403-516,635-774
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-63
Family Phosphate binding protein-like 0.00000000288
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000009556
Domain Number - Region: 538-630
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000877
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number - Region: 758-860
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.0151
Family DHN aldolase/epimerase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009556   Gene: ENSSTOG00000010632   Transcript: ENSSTOT00000010644
Sequence length 888
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:19156172:19363477:-1 gene:ENSSTOG00000010632 transcript:ENSSTOT00000010644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHVIRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDS
FEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVN
LYPDYASLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDS
DDARPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEP
YRYSGVNLTGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVH
IVSVCYQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFD
LDIISLKEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRK
SDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHK
ADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLL
AYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPK
ALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGA
TMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYVTQRNC
NLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENK
EASALGIQKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQRSFCSTVADEIRFSLT
CQRRVKHKPQPPMMVKTDAVINMHTFNDRRLPGKDSMTCSTSLAPVFP
Download sequence
Identical sequences ENSSTOP00000009556 ENSSTOP00000009556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]