SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009652 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009652
Domain Number 1 Region: 34-230
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.24e-32
Family PaaI/YdiI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009652   Gene: ENSSTOG00000010754   Transcript: ENSSTOT00000010756
Sequence length 240
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:2036713:2043897:-1 gene:ENSSTOG00000010754 transcript:ENSSTOT00000010756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRRSFQVAARLGHRCILPRLDPAAAFGSSTDSLVSRFCPVKTDLKDYALPNASWCPDML
SLYQEFLEKTKSDGWVKLPSFQSNRDHIQGLKLPSGLVAASDKSDWRIFTRCIQVEGQGY
EYVIFFHPFKKKSVCLFQPGPYLEGPPGFAHGGSLAAMMDETFSKTAYLAGEGLFTLNLN
IRFKNLIPVGSLAVLNVQVEKIEDQKLYMSCIAQSRDQETVYAKSSGVFLQWQLEEESSP
Download sequence
Identical sequences XP_005331485.1.77405 ENSSTOP00000009652 ENSSTOP00000009652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]