SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010044 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010044
Domain Number 1 Region: 148-391
Classification Level Classification E-value
Superfamily vWA-like 3e-80
Family Integrin A (or I) domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 371-481
Classification Level Classification E-value
Superfamily Integrin domains 4.03e-24
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000379
Family Integrin beta tail domain 0.0099
Further Details:      
 
Domain Number 4 Region: 44-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000361
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010044
Domain Number - Region: 534-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010044   Gene: ENSSTOG00000011195   Transcript: ENSSTOT00000011199
Sequence length 798
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:10484853:10494456:-1 gene:ENSSTOG00000011195 transcript:ENSSTOT00000011199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSVALVFLLALGRGESEVDIKSPFPREATKLGDPDLSLPGSCQPAPSCKKCIFSHPS
CAWCKQLNFTASGEAESRRCARREELLARGCPPEELEEPRGRQEVLQDKPLSQGNRGEGA
TQLAPQRVRVVLRPGEPQRLRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPSRMERCQPPFSFHHVLSLTGDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPIYQELS
QLIPKSAVGELSEDSSNVVQLIMDAYDSLSSTVTLEHFSLPPGVNISYESQCGGSEKSEV
EAGDRGQCNNVRINQMVNFWVTLQANNCLPEPQFLRLRALGFSEELTMELHTLCDCNCSD
TQPQAPHCSDGQGDLQCGICSCASGRLGRLCECSEAELFSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCVSPEGELCSGHGHCKCNRCQCLDGYYGALCDQCPGCKTPCERYRDCAECGAFGTG
PLAANCSMACAHANVTLALTPILDDGWCKERTLDNQLFFFLVEDEAGGKVTLRVKPQEKG
ADQTQTIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKERQQLNWKEDNNPLYKS
AITTTINPRFEGADGPIL
Download sequence
Identical sequences XP_013213889.1.77405 ENSSTOP00000010044 ENSSTOP00000010044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]