SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010233 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010233
Domain Number 1 Region: 621-1141
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-141
Family alpha-mannosidase, C-terminal domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 126-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.26e-138
Family alpha-mannosidase 0.00000000176
Further Details:      
 
Domain Number 3 Region: 502-603
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.16e-25
Family alpha-mannosidase, domain 2 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010233   Gene: ENSSTOG00000011382   Transcript: ENSSTOT00000011402
Sequence length 1145
Comment pep:known_by_projection scaffold:spetri2:JH393341.1:4331455:4491619:1 gene:ENSSTOG00000011382 transcript:ENSSTOT00000011402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPSSPRREGSYPQAQLSVLQEKIDHLER
LLAENNEIISNIRDSVINLSESVDDDSKDSQGNFSQGAGSQLQQSELYIQVDPSDCLSLS
QTGSLQPDVQMLDVYNLIPFDNPDGGVWKQGFDIKYEDHEWDDESLQVFVVPHSHNDPGW
LKTFNEYFREKTHYIFNNMVIKLKEDSSRKFMWSEISYLSKWWDIVDTQKKEAVKRFLQT
GQFEVVTGGWVMPDEATSHYFALIDQLIEGHQWLEKHLGVKPRSGWAIDPFGHSPTMAYL
LKRAGFSHMLIQRVHYAVKKHFAQHKTLEFFWRQNWDLGSATDIFCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGSYDCPWGRPSEEISSENVQRRALLILDQYRKKSKLFRTKVLL
APLGDDFRYTDYSEWDLQFKNYEYLFKYMNSQPQLGVKIQFGTLSDYFDAVDKADEAMKK
KGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIVESHAIRAAEIIYYFAQTQA
QRYKINKFLLSTYYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTSLVKTLNSIGSII
QIVTVLTLLKFKESYSSDPLLEMSSIQKSQDSLPQNHVIKPSIQEPRYLVIYNPLEQHRD
SVVSTYVNNPNVQVLTDAGRLLDIQVSAVWIKEDTISQEVYKISFIAQTPPLGLKVYTLL
ETGKSDSYLAEYVVYNGEATSEIFNIKSMTSDSEPIILENPHLILSFDKTGLMETMMTRE
DKQIHEIKVQFTWYGTTSKKDKSGAYLFLPDGFAQPYVYKKAPFVRVVHGKIYSEVTSYF
EHVSHTVRLYNLRGIEGRSVEISNIVNIRNVYNREIAMRISSEINSQNRFYTDLNGYQIQ
PRMTLSKLPLQANVYPMTTMAYIQDAKNRLTLLSAQSSGVSSLKSGDIEVIMDRRLMQDD
NRGLGQGVTDNKITANLFRILLEERSGVDMEEEKKSPVSFPSLLSHITSSFLNHPVFLMT
AKVKLSSELLSEFSPLVSSLPCDIHLVNLRTIQAKEGKGYSSDAALILHRKGFGCQFSTS
GMGLLCSTTQGKISVYKLFDMFTIEDFVPSSLSLMHTPPVAQNISVIYLSPMEISTFRIR
LSFWL
Download sequence
Identical sequences ENSSTOP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]