SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010498 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000010498
Domain Number - Region: 170-244,330-361,461-566
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00212
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010498   Gene: ENSSTOG00000011700   Transcript: ENSSTOT00000011700
Sequence length 579
Comment pep:known_by_projection scaffold:spetri2:JH393422.1:2262324:2294126:-1 gene:ENSSTOG00000011700 transcript:ENSSTOT00000011700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFQIFLHFVRNRSTTAVGFLSVAVYRLPVLKTYMENTHQKKTLLGQRQNLPCIAPLLTT
VEETVQNISAQVKGHIPEWLHGYLLRVGPGKFEFGKDKYSHWFDGMALLHQFRMEKGTVT
YRSKFLQSDTYKTNSVGNRIVISEFGTLAFPDPCKNIFERFLSKFEQPGKQPSMTDNTNV
NYVQYKGDYYMSTETNFMNKVDIETLEKIEKVDWSKFIAVNGATAHPHYDPDGTAYNMGN
SYGPQGSCYNIIRVPPEKVDLGETIHGAQVICSISSEEKMKPSYYHSFGMTKNYIIFIEQ
PLKMNLWKFVTSKIRGKAFSDGISWEPQYNTRFYVVDKHTGQLLPGMYYSKPFITFHQIN
AFEDEGCIIIDMCCQDNGRNLDIYQLQNLRKSGEGLDQVYNSAALSFPRRFVLPLHISEN
DPAGENLSPLSYSSASAVKQSDGKIWCSHENLHYEDLEEEGGIEFPQINYGQFSGKKYNF
FYGCGFRHLVGDSLMKVDVINKSLKFWREDGFYPSEPIFVPVPGAKEEDDGIILSVVITP
KQNENNFLLVLDARNFEELGRAEVPVQMPYGFHGTFVPI
Download sequence
Identical sequences ENSSTOP00000010498 ENSSTOP00000010498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]