SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010655 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010655
Domain Number 1 Region: 203-485
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.89e-35
Family NadC C-terminal domain-like 0.056
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010655
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.00012
Family NadC N-terminal domain-like 0.016
Further Details:      
 
Domain Number - Region: 87-118
Classification Level Classification E-value
Superfamily DUSP-like 0.0968
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010655   Gene: ENSSTOG00000011874   Transcript: ENSSTOT00000011880
Sequence length 492
Comment pep:novel scaffold:spetri2:JH393289.1:17682201:17716664:1 gene:ENSSTOG00000011874 transcript:ENSSTOT00000011880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYFTTIN
FSGFLDTFDGRIDGYTDKINTSHTAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPG
YSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLI
VSRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDIN
TLQEIVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVA
DPNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKN
AQLNIELEAAPH
Download sequence
Identical sequences ENSSTOP00000010655 ENSSTOP00000010655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]