SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010699 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010699
Domain Number 1 Region: 103-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000188
Family VWC domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010699
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily FnI-like domain 0.00293
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number - Region: 176-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.00575
Family VWC domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010699   Gene: ENSSTOG00000011936   Transcript: ENSSTOT00000011928
Sequence length 222
Comment pep:known_by_projection scaffold:spetri2:JH393396.1:2390327:2535324:-1 gene:ENSSTOG00000011936 transcript:ENSSTOT00000011928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADESDQTSSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
Download sequence
Identical sequences A0A287DCC6
XP_004674380.1.23501 XP_005331911.1.77405 ENSSTOP00000010699 ENSSTOP00000010699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]