SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010769 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010769
Domain Number 1 Region: 33-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.73e-37
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 414-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000000836
Family Phosphate binding protein-like 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010769   Gene: ENSSTOG00000011995   Transcript: ENSSTOT00000012002
Sequence length 491
Comment pep:known_by_projection scaffold:spetri2:JH393516.1:410839:468529:1 gene:ENSSTOG00000011995 transcript:ENSSTOT00000012002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLVLRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINR
Download sequence
Identical sequences ENSSTOP00000010769 ENSSTOP00000010769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]