SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011334 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011334
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.7e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000103
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000134
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011334   Gene: ENSSTOG00000012628   Transcript: ENSSTOT00000012646
Sequence length 857
Comment pep:known_by_projection scaffold:spetri2:JH393318.1:5857890:5895324:-1 gene:ENSSTOG00000012628 transcript:ENSSTOT00000012646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAESGEKKSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKTGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGYKEPLLSCLIVMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDNSGEVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNPE
ESPYRKAILPPGQPWAAELRSHGAQNEVGSLPAFTVPQAAALGSTTPSATSSSSSCSTPS
SPGDYYSSLGDDLKIEVIEKLFAMDTESKDQCSTQTDFNELDLETLAPYIPMDGEDFQLS
PICPEEPCLPESPQPAPQHCFSAMTSIFQPLAPVASHGPFLLDKYQQQLENKKTEPEHRP
MSSIFFDAGNKGSLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPAGDQHTESLG
ASPLGPPIASPQVSLFKMRSAKGFGPRGPDAMSPAMIALSNKLKLKRQLEQGDPPGGSNP
HLMWKRMKSLRGGNCPLMPDKPRSARGPTDDFTQNPMRGLGQPLRHLPPPQPPSAISSRE
TTKSGFPLQCCASQYQNYSLPSTPKVSGMASRLLGPSFEPYLLPELTRYDCEVNVPVPGS
STLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSSTOP00000011334 ENSSTOP00000011334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]