SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011417 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011417
Domain Number 1 Region: 265-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000558
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 
Domain Number 2 Region: 120-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000812
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 29-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000262
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011417   Gene: ENSSTOG00000012735   Transcript: ENSSTOT00000012741
Sequence length 795
Comment pep:novel scaffold:spetri2:JH393306.1:14851383:15016432:-1 gene:ENSSTOG00000012735 transcript:ENSSTOT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNF
NFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEAL
DGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNG
GSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGE
DLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRC
IQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNE
PQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQAMCSGNPGQDMTLSSNI
NFPMNGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPN
SMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEG
HGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESS
CHPAEQKETNDSSMPPTTSGERAEGQNRLHDSKGQTKLLQLLTTKSDQMEPSPLPSSLSD
TNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESSSTA
PGSEVTVKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPAGNTKLIA
MKTEKEDMSFEPSDQ
Download sequence
Identical sequences ENSSTOP00000011417 ENSSTOP00000011417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]