SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011655 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011655
Domain Number 1 Region: 102-304
Classification Level Classification E-value
Superfamily DNA-glycosylase 9.58e-59
Family Endonuclease III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011655   Gene: ENSSTOG00000013011   Transcript: ENSSTOT00000013007
Sequence length 308
Comment pep:known_by_projection scaffold:spetri2:JH393504.1:1993488:2000229:1 gene:ENSSTOG00000013011 transcript:ENSSTOT00000013007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGSGMSAGLRMLTRSRSRSPRTRPRGGGEEPASIPRREVAAEGREKHRPGKCQQKTQRL
HVAYEALDGEKGEGAEPLKVSAWEPQGWQQQLANIRTMRSKKDAPVDQLGAEHCYDPSAP
PKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDSTLGELIYPVGFWRS
KVKFIKQTSAILQQHYDGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHR
IANRLRWTQRPTKSPEATRAALEEWLPRELWSEINGLLVGFGQQTCLPVHPRCQACLNQA
LCPTAQGL
Download sequence
Identical sequences ENSSTOP00000011655 ENSSTOP00000011655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]