SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011705 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011705
Domain Number 1 Region: 1336-1474
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 240-340
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000038
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011705   Gene: ENSSTOG00000013058   Transcript: ENSSTOT00000013061
Sequence length 1480
Comment pep:known_by_projection scaffold:spetri2:JH393377.1:3499917:3590136:-1 gene:ENSSTOG00000013058 transcript:ENSSTOT00000013061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVETPGGQKRLNKSFYLLPVLSLLLARYRKEQTL
LKQLPCIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQE
FCQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVCPQGAEPV
KDMPSIPVLNAAKRNVLDSSCSSDFTSRYSRPQAHSSASGGIRRSSSMSYVDGFIGTWPK
EKRSSVHGVSFDISFDKEDSEQRSTSNRGITRSISNEGLTLNNNRVSKHIRKNLSFKPVN
GEEEAESIEEELNIDSQSDFKSYVPLNTNELNSNENIHYKLPNGALQNRVLLDEFGNQIE
TPSIEEALQIIHDTERSPHTPRPDQIANGFFLHNQEMSILNSNIKLNQSSPDNITDTKGA
LSPITDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTSNPR
DALSPCPSTISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSE
LNIPHVVAWAQIPEETGLPQARDTTQLLASEMVHLRMKLEEKRRAIEAQKKKMEAAFTKQ
RQKMGRTAFLNVVKKKGDGISPLREEAAGAEDEKVYTDRTKEKESQKTDGQRSKSLADIK
ESMENPPAKWLKSPTTPVDPEKQWNLASPSEETLNEGEILEYTKSIEKLNSSLHFLQQEM
QRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSRQAGLSSAIAPFSSDSPRPTHP
SPQSSNRKSTSFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRS
FVCFGDDGEPQLKESKPKEEVKKDELECKGTLEQHGHNLEEKELKPFESTVSEVLSQPIT
ETVCLTPNEDQLSQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADESVEKYDGESD
KEPLEDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKE
ETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQMAKQKKQRPKSI
HRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEAFLSPSRCGSRNGE
KDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEE
MEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRK
QFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences ENSSTOP00000011705 ENSSTOP00000011705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]