SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011963 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011963
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.29e-98
Family Carbonic anhydrase 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011963   Gene: ENSSTOG00000013348   Transcript: ENSSTOT00000013349
Sequence length 262
Comment pep:known_by_projection scaffold:spetri2:JH393354.1:177497:204625:1 gene:ENSSTOG00000013348 transcript:ENSSTOT00000013349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYGEHNGPIHWNEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFSVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHMVDGVKYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEHNSQLQKITDILDSIKEKGKQIRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLLSNHRPPQPLKGRKVRASFY
Download sequence
Identical sequences I3MKU5
ENSSTOP00000011963 XP_005328682.1.77405 ENSSTOP00000011963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]