SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011977 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011977
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.54e-102
Family Carbonic anhydrase 0.000000000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011977   Gene: ENSSTOG00000013370   Transcript: ENSSTOT00000013367
Sequence length 260
Comment pep:known_by_projection scaffold:spetri2:JH393354.1:362291:378689:1 gene:ENSSTOG00000013370 transcript:ENSSTOT00000013367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVNIDTKIAKHDPSLKPLCLCYEQPTSRRIV
NNGHSFNVEFDDSQDTAALKGGPLDGTYRLIQFHFHWGSSDGQGSEHTVDKTTYAAELHL
VHWNTKYKDFGKAVEQPDGLAVLGIFLKIGSANPGLQKVLDMLDSIKTKGKSSDFTGFDP
RGLLPKNLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMSKFRQLNFNFEGEPEELM
VDNWRPAQPLKNRQIKASFK
Download sequence
Identical sequences I3MKV4
ENSSTOP00000011977 XP_005328686.1.77405 ENSSTOP00000011977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]