SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012189 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012189
Domain Number 1 Region: 323-500,535-701
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.46e-81
Family YicI catalytic domain-like 0.00077
Further Details:      
 
Domain Number 2 Region: 1198-1376,1465-1605
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.16e-58
Family YicI catalytic domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 79-322
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.59e-52
Family YicI N-terminal domain-like 0.008
Further Details:      
 
Domain Number 4 Region: 948-1194
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.48e-44
Family YicI N-terminal domain-like 0.0052
Further Details:      
 
Domain Number 5 Region: 704-784
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000237
Family Putative glucosidase YicI, domain 3 0.023
Further Details:      
 
Domain Number 6 Region: 917-973
Classification Level Classification E-value
Superfamily Trefoil 0.00000000000133
Family Trefoil 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000012189
Domain Number - Region: 1608-1688
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00662
Family Putative glucosidase YicI, domain 3 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012189   Gene: ENSSTOG00000013592   Transcript: ENSSTOT00000013604
Sequence length 1828
Comment pep:known_by_projection scaffold:spetri2:JH393517.1:1153538:1228220:-1 gene:ENSSTOG00000013592 transcript:ENSSTOT00000013604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFSGLEISLIVLFAIVTIIAIALVVVLATKTPAVDELSHPTSTPAGVGKCPAALND
PINERINCIPDQFPTQAICAQRGCCWRPRNDSIVPWCFFADNHGYNAEESTTSSTGLETK
LNRIASPTLFGKDINNVLLTTQSQTPNRFRFKITDPNSKRYEVPHQFVKEFTGPTSSETL
YDVQVQKNPFSIKVIRKSNSKILFDTSIGPLVYSDQYLQISTRLPNEYIYGIGEHIHKRF
RHDLYWKRWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNAMEIFIQPT
PIVTYRVTGGILDFYIFLGDTPEQVVQQYQELIGLPAMPAYWSLGFQLSRWNYKSLDVVK
EVVQRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFKGLPEFVEDLHNHGQKYVIILDPA
ISIEKRADGAPYETYERGNAQKVWVNKSDGITPIIGEVWPGLSVYPDFTNPNCINWWANE
CSDFHQTVKYDGLWIDMNEVSSFVQGSTEGCSENSLNYPPFTPDILDKLMYSKTICMDAL
QNWGKQYDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGHHAAHWLGDNTASW
EQMEWSIAGMLEFSLFGTPLVGADICGFVVDTTEELCRRWMQLGAFYPFSRNHNADGYEH
QDPAFFGQNSLLVNSSRHYLNIRYTLLPFLYTLFYKAHMFGETVARPVLHEFYEDTSSWI
EDTEFLWGPALLITPVLKQGAESVNAFIPDATWYDYETGAKRPWRKQRVDIPLPADKIGL
HLRGGYIIPTQEPAVTTTASRKNPLGLIIALNETNMAQGDFFWDDGESKDSIEKGNYILY
TFSVSDNILNIVCSHASYQEGTTLAFETIKVLGLTDTVTEVTVKESGQPVIPHSSFTYDA
SNQILLIRSLNLKLGKSFTVGWNQVFTENERFTCYPDADEVTEPKCIQRGCLWQTAESSA
PLCYFPKQYNPYVVTSTQYLPTGITADLQWNTRNAKIALPSVPISTLRVEVKYHKNDMLQ
FKIYDPQNKRYEVPVPLNIPTTPTSTYENRLYDVEIKENPFGIQIRRRSSGRVIWDSRVP
GFAFNEQFIQISTRLPSEYIYGFGEAEHTAFKRDLNWHTWGMFTRDQPPGYKLNSYGFHP
YYMALEDEGNAHGVLLLNSNAMGFPDVTFQPTPALTYRTIGGILDFYMFLGPTPEVATKQ
YHEVIGKPVMPPYWALGFQLCRYGYRNTSEIVQLYDAMVAAGIPYDVQYTDINYMERQLD
FTIGENFHDLPQFVDRIRGEGMRYIIILDPAISGNETKPYPPFERGMEKDVFVKWPNTSD
ICWAKVWPDLPNVTIDESITEDEAVNASRAHVAFPDFFRNSTAEWLSNMIFDIFCMLSKY
YMILCLLSKDTSYIISLLMTKVVYDEICLIRYLSEKIYKSTEYLHFNIVNVGREETIPTP
PTTILKKQKSFIPVRILLWSERKKMPYDNNAVQKTTGKRGIVISRSMYPTGGRWGGHWLG
DNYAQWDNLDKSIIGMMEFSLFGISYIGADICGFFNNSEYHLCARWMQLGAFYPYSRNHN
IAFTRRQDPVSWNETFAAMSKRILDIRYTLLPYFYTQMHEVHAHGGTVIRPLLHDCYVNQ
AFWKYVLDLLLKPQFDIWQILRLYDDTVEGYIPNARWFNYYTGEDIGFRGKNSTFPTDWD
KINLHVRGGYILPCQEPAQNTFYSRKNFMKLIVAADDNQMAQGSLFWDDGDTIRTLEAQK
FEESIINLVKTCYKIKIYAKKYLVSEFIRLESLKLSSTWRTPITDFSLLYNENKNILLFS
LSTDTYVLKIDLTDKSVTLDEPFEISWS
Download sequence
Identical sequences ENSSTOP00000012189 ENSSTOP00000012189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]