SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012420 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012420
Domain Number 1 Region: 157-243
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 9.42e-19
Family Translation initiation factor IF3, C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 78-148
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000000114
Family Translation initiation factor IF3, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012420   Gene: ENSSTOG00000013866   Transcript: ENSSTOT00000013864
Sequence length 278
Comment pep:known_by_projection scaffold:spetri2:JH393282.1:22683728:22687401:-1 gene:ENSSTOG00000013866 transcript:ENSSTOT00000013864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLKRLMLQTLRTENNCIRRCFDKHIVQKTVPAQLSLVASAPRLPYLIHAKRFSTVED
SQDERKTKKKNDTTFSNIGRKIGERIIRVLDEKGNDLGNMHRADAIRLMEERDLRLVRRN
ASTEPPEYQLMTGTQIHQERLRLRDMEKAKLKPGPAVRKELTFSSNIEQHDLDTKSKQIQ
QWIEKKYQVQITIKKGKNADEQENKMEEILNQIVQTMPGIATFLSKPQPVKGGKGLMCVL
RHLTKKEEMAHGDLQEAQKRDIVNKENGNDKESNVLHQ
Download sequence
Identical sequences I3MLU1
XP_005317109.2.77405 XP_021585775.1.77405 ENSSTOP00000012420 ENSSTOP00000012420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]