SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012547 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012547
Domain Number 1 Region: 782-873
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000157
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 10-53
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000171
Family LEM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012547   Gene: ENSSTOG00000013995   Transcript: ENSSTOT00000014001
Sequence length 913
Comment pep:known_by_projection scaffold:spetri2:JH393355.1:3385856:3451871:1 gene:ENSSTOG00000013995 transcript:ENSSTOT00000014001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASGPQQLSDEELFSQLRRYGLSTGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNTAAAVGMGVRPVSGDLSYLRTPGGLSRISVSGPESPLGGPGGASATPVAGSKVLL
GFSSDESDVEASPRDQAGGGGRRDRAALQYRGLKAPPAPLAASEVTNSNSAERRKPHSWW
GARRPTGLELQTPLGKDGAAEDEEEEGEDGEERDLEAEEPLWASRAVNGSRLLPYSCREN
YSDSEEEEDDDVATRQVLKDDSLSRHRPRRSHSKPLSPLTAKSAGSRRETSVQGGGGLAM
NDRAAAAGSLDRSRNLEEAAAELGGGCDQVDCSPIPRYRVSSKKLAPLLPPPLPDMDSTL
DSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSPAVAAPTSLRINHANHTGSNHTYLKN
AYSKPKLSEPEEELLQQFKREEVSPAGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTG
VSEDGGLIKNPFDETFGKIQESEKNLMMSTLYKLHDRLAQLAGDHECGSSSQRTLSVQEA
VAYLKVIILITMTLKNKTIKRTPNQMNDLGPEYEDIFNTSLQWILENGKDVGIRCVGYSP
EEELKNITDVQFLQSTRPQMSFWCRFRRAFITVTHRLLLLCLGVVMVCVVLRYMKYRWTK
EEEESRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDR
AIDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSP
PNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKC
LSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCNTPLKPSNKHMNSMSHL
RLRTGLANSQGGS
Download sequence
Identical sequences ENSSTOP00000012547 ENSSTOP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]