SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012561 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012561
Domain Number 1 Region: 231-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.11e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012561   Gene: ENSSTOG00000014007   Transcript: ENSSTOT00000014020
Sequence length 1134
Comment pep:known_by_projection scaffold:spetri2:JH393433.1:2290651:2336634:1 gene:ENSSTOG00000014007 transcript:ENSSTOT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SREQDRNRVSEELLMVVQEMKKYFPAERRSKPSTLDALNYALRCVRSVQANSEFFQIHNL
NGAPEREVTVYSLKELATVASELTSKNTDTFVAVFSFLSGRLVHISEQAALILNCKKDFL
KSCHFVDLLAPQDVRVFYTHTARAQLPFWSSWSQRASQYECAPVKPFFCRIRGGGGREHE
KHYSPFRIIPYLVHVHSSTQPESEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVF
LEIDERAVPLLGYLPQDLTGTSVLACLHPEDRPLMVTMHQKVLKYAGHPPFEHSPIRFCT
QNGDYIILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKTNSNEKDITELQ
EQIHRLLLQPVHVSTSSGYGSLGSSGSQELQVSVDSSSESSGHCLEEVQKEPMTLKQVYS
SVNKIKNLGQQLYIDSMARSSVKPVMGTCPEPSGGDEQKASSSSLTLKNKCTCTEFCEDL
RKDQHSSSYQQMNCIDSVIRYLKSYHIPALKRKCVSSTNTMASSSEEEKPSHQADDTQAV
QAVAQTPAMPQPKVPTNGRPTEAEADLAGTLSTATLSLGSGTSQCSCSSTIVHVPPPEPA
EDAALGCEPWTLNTQPAPFTAEEFKHVGLTTASLSAHTQREEQDYVDRFRKKILSSPYSC
CLHRESSSKARRSCVQGDFTSKQSRLAGCRKGKHKRTKPPVPLGSSSSSDSFHSQAGGPL
QDVLPWCPSTPSSACASGLGFPAAVMVPSQSSYLLPAFPLPAWAATPECPPKPPVSSGLQ
HLPALPSLHVDTLMTFFLHNPRICPLWSPSFSPYPFLGATDSSEILPSVSAVAPNLEPPP
SVNSGRVEENWEMQKEEHLFISSRSSSPLQLDLLHEDMPASPEPPDAVRRDAGPEATDHC
VSGGGGSRSSSAAGDLSPAPPHKVSPSGAGSAASGSGSGKPLLQTLLSRGCCVEGHLTEA
LVSGPPAGLVVRSSWPPQTWKSVFSSVVDFFSGSSSSCIFFTSTDYSSESSENGQQSQDT
QKTSAFHSLAEDPIWKMIAQTPECVLMTYQVPERVKEVVLKEDLEKLESLRQQQPQFSPG
QKEELAKVHPWIQSQTVPGGMHVQSCATCEDGGSAGDTAEAPGRIQEKTAAEPP
Download sequence
Identical sequences ENSSTOP00000012561 ENSSTOP00000012561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]