SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012640 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012640
Domain Number 1 Region: 359-700
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.93e-135
Family Transferrin 0.000000000107
Further Details:      
 
Domain Number 2 Region: 22-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.1e-127
Family Transferrin 0.0000000000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012640   Gene: ENSSTOG00000014098   Transcript: ENSSTOT00000014108
Sequence length 701
Comment pep:known_by_projection scaffold:spetri2:JH393339.1:6917876:6947349:1 gene:ENSSTOG00000014098 transcript:ENSSTOT00000014108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSVGALLACAFLGLCLAVPEKTVRWCAVSDHEANKCVAFRDNMKKVLPADGLRMACVK
KTSYLDCIKAIAANEADAVTLDAGLVYEAGLTPNNLKPVAAEFYGTPENPQTFYYAVAVV
KKGSGFQLNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPC
ADGVAFPQLCQLCPGCGCSSAQPYFGYSGAFKCLKDDAGEVAFVKHLTIFENLEQKADRD
QYELLCPDNTRKPVDEYENCHLARIPSHAVVARSMGGKEDLIWELLNQAQEHFGKDKSGD
FQLFSSPHGKNLLFKDSALGFLRVPPKMDFRLYLGYEYVTAIRNLREGICPESPVDECKT
VKWCALSHHERLKCDEWSINSNGKIACESAESTEDCITKIMNGEADAMSLDGGYVYIAGQ
CGLIPVMAENYVSRTHASYCCLVAVFLIGYYAVAVVKKSDADITWNSLKGKKSCHTAVDR
TAGWNIPMGLLYNQINHCRFDEFFSQGCAPGYEKNSSLCKLCIGPYVCVPNSKEDYFGYR
GALRCLVEKGDVAFVKHQTVSQNTGGKNPEEWAKNLKEEDFELLCLDGTRKPVSEAKNCH
LARAPNHAVVSRKDKAACVREVLRSQVMKYGSHVSDCSSEFCLFSSETKDLLFRDDTKCL
VRLPDDTTYEKYLGAEYITAVGNLRKCSTSRLLEACTFHKY
Download sequence
Identical sequences ENSSTOP00000012640 ENSSTOP00000012640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]