SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012674 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012674
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.34e-22
Family Extradiol dioxygenases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012674   Gene: ENSSTOG00000014150   Transcript: ENSSTOT00000014149
Sequence length 137
Comment pep:known_by_projection scaffold:spetri2:JH393531.1:722581:731533:1 gene:ENSSTOG00000014150 transcript:ENSSTOT00000014149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSSQTPSRCLIHRLDHIVMTVKSIKDTTMFYSKILGMEVITFKGDRKALCFGDQKFNLH
EVGKEFEPKAAHPIPGSLDLCLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSVY
FRDPDRNLIEVSNYVSL
Download sequence
Identical sequences ENSSTOP00000012674 ENSSTOP00000012674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]