SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012729 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012729
Domain Number 1 Region: 286-651
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4e-66
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 
Domain Number 2 Region: 30-228,285-362
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.38e-23
Family SGL-like 0.054
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000012729
Domain Number - Region: 844-890
Classification Level Classification E-value
Superfamily Bacterial polysaccharide co-polymerase-like 0.00811
Family FepE-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012729   Gene: ENSSTOG00000014194   Transcript: ENSSTOT00000014209
Sequence length 923
Comment pep:novel scaffold:spetri2:JH393310.1:246468:264482:-1 gene:ENSSTOG00000014194 transcript:ENSSTOT00000014209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTIFDLKNNKSDTLPLATRYNIKC
VGLSPDGRLAIIVDEGGAALLVSLVCRSVLHHYHFKGSVHSVSFSPDGRKFVITKGNLAQ
MYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLI
YYALGGHKDAIVACFFESNSLDLYSLSQDGALCVWQCDTPPEGLRLKAPTGWKADLLQRE
EAQEEEEEEEGQREITIRGKATPAEEEKKGKVKYSRLAKYFFNKEGDFNSVTAAAYHKKI
RLLVTGFASGIFHLHELPEFNLIHSLSISDQRITSVAINSSGDWIAFGCSGLGQLLVWEW
QSESYVLKQQGHFNSMVSLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFITFTEHSSGVTG
VAFTATGFVIVTSSLDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDSSGEIISAGAQDS
FEIFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETL
TLTSDALAVTFRPDGAELAVATLNSQITFWDPENAIQTGSIEGRHDLKTGRKELDKITAK
HSAKGKAFTTLCYSADGQSILAGGMSRFVCLYHVREQILVKRFELSCNLSLDAMEEFLNR
RKMTEFGNLALIDQDAGEEDGVAIPLPGVKKGDMSSRHFKPEIRVTSLRFSPTGRCWAAT
STEGLLIFSLDAQMLFDPYELDTSITPGRVREALHQQEFTRAILMAFRLNEKKLVQEVLE
AVPREDIEVVSASLPELYVEKALEFLASSFEVSRHLEFYLIWTQKLLMSHGQKLKPSAGR
LLPAIQFLQKSLQRHLDDLAKLCDWNRYNLRYALAISKQQGVKRPLDLPGVEDDGEASDE
DSLNLLGGAGDEPTATAAPDCLG
Download sequence
Identical sequences I3MMG8
XP_005323632.1.77405 ENSSTOP00000012729 ENSSTOP00000012729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]