SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012879 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012879
Domain Number 1 Region: 253-318
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000523
Family VWC domain 0.0097
Further Details:      
 
Domain Number 2 Region: 1085-1157
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000743
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 78-140
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000178
Family VWC domain 0.0024
Further Details:      
 
Domain Number 4 Region: 426-494
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000199
Family VWC domain 0.0046
Further Details:      
 
Domain Number 5 Region: 141-199
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000022
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 544-609
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000492
Family VWC domain 0.0074
Further Details:      
 
Domain Number 7 Region: 722-788
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000753
Family VWC domain 0.0082
Further Details:      
 
Domain Number 8 Region: 841-907
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000115
Family VWC domain 0.016
Further Details:      
 
Domain Number 9 Region: 372-433
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000649
Family VWC domain 0.0034
Further Details:      
 
Domain Number 10 Region: 899-964
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000067
Family VWC domain 0.0069
Further Details:      
 
Domain Number 11 Region: 202-260
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000534
Family VWC domain 0.018
Further Details:      
 
Domain Number 12 Region: 958-1033
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000136
Family VWC domain 0.0068
Further Details:      
 
Domain Number 13 Region: 665-728
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000502
Family VWC domain 0.022
Further Details:      
 
Domain Number 14 Region: 311-370
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000555
Family VWC domain 0.076
Further Details:      
 
Domain Number 15 Region: 485-546
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000555
Family VWC domain 0.026
Further Details:      
 
Domain Number 16 Region: 1426-1491
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000103
Family ATI-like 0.05
Further Details:      
 
Domain Number 17 Region: 1026-1092
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family VWC domain 0.0068
Further Details:      
 
Domain Number 18 Region: 614-671
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000691
Family VWC domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000012879
Domain Number - Region: 39-75
Classification Level Classification E-value
Superfamily FnI-like domain 0.000136
Family VWC domain 0.036
Further Details:      
 
Domain Number - Region: 781-840
Classification Level Classification E-value
Superfamily FnI-like domain 0.000544
Family VWC domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012879   Gene: ENSSTOG00000014371   Transcript: ENSSTOT00000014380
Sequence length 1498
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:15801363:15824012:-1 gene:ENSSTOG00000014371 transcript:ENSSTOT00000014380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLEERLGQLEAEVLELREQNRDLQERVKRLESCECHLASSQCWGLGRIWPEGARWEPDAC
TACICQDGAARCGPQPNLPHCHGCKHNGQTYSHGETFSPDTCSICHCQAGTVRCQGSSCS
ELNCLESYTPPGECCPVCRPGCEYEGQLYEEGASFLPSSNPCLQCSCQRSLVRCVPLKCP
PSPCPEPVLRPGHCCPACQAPGCTEGGSQRDHGQEWTAPGDPCRICQCLEGHIQCRQREC
ASLCPYPARPLPGTCCPVCDGCFLNGREHRSGEPVGSGDPCLQCRCANGSVQCEPLPCPP
VPCRHPGRIPGQCCPVCDSCEYQGHQYQSQETFSLQESGRCVRCSCQAGEVSCEEQECPV
APCGPPTSGPQLCPACVLDGEEFAEGVQWEPDGQPCTSCSCQDGMPVCRAVLCPPTPCQH
PTQPPGACCPSCESCTYHGQVYANGLNFTDADSPCHTCRCEDGTVRCSLVYCPPMTCARP
QSGPGQCCPKCPDCILEKQVFVDGESFSHPGDPCQECQCQEGHALCQPRACPKALCAHPL
PGTCCQNNCSGCAYGGKEYPNGADFPHPSDPCRLCHCLGGNVQCLARRCPPLPCPEPVLP
QGDCCPQCPASPAGCMWPGFTVPARHQEHFSPPGDPCRRCLCLDGSVSCQRLPCLPALCA
HPRQGPCCPSCDGCLYQGKEFASGERFPSPSVACHTCLCWEGSVSCEPRVCAPAQCPFPA
RDDCCPACDGCEYLGESYLSLQEFSDPREPCNLCTCLGGFVTCSRQPCEPLGCSHPLTPP
GRCCPTCQGCFYHGVTAALGETLPDPLDPTCSLCTCQVRQCLCKKKPCSSVLCTHPSPGP
CFCPVCHSCLSQGREYQDGEEFEGPLGSCEQCRCQAGQVSCVRLRCPPLPCLLQVTEPGS
CCPRCRGCLAHGEEHPEGSSWVPPDSPCSSCMCHEGIVTCASVQCVSSCAQPHQGPTDCC
PRCSDCVHDGRKYEPGESFQPGADPCELCICESQSEGPPSLHCRRRQCPSLLDCPPSQLL
PPDAQHCCPTCAQALSNCTEGLLGSELAPLDPCYTCQCQDLTWLCTHRACPQLSCPLLEH
HIPPGSCCPVCQAPTQSCVHQGRQVAVGEHWAVDTCTSCSCVAGTVRCQSQRCPPLSCGQ
DEAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGGDFSVH
VTNNDRGRRGVAWTQEVAVLLGDMVVQLLHGKTVMVDGSPVALPFLQEPLLYVELWGRSV
ILHTQPGLKVLWDGQSQVEVSVPGSYRGQTCGLCGNFNGFAQDDLQGPDGLLLPTEAAFG
NSWQVPEGPSPGRPCSAGQEVDPCRAAGYRARREANARCGLLRSSPFHRCHAVVPPEPFF
AACVYDLCACGPGSSADTCLCDVLEAYASHCRQAGVTPAWRGPTLCVMGCPLDRGFVFDE
CGPPCPRTCFNQHVPLGDLEAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPPVLLTGD
Download sequence
Identical sequences ENSSTOP00000012879 ENSSTOP00000012879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]