SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012916 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012916
Domain Number 1 Region: 8-226
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.06e-76
Family Phosphate binding protein-like 0.00000409
Further Details:      
 
Domain Number 2 Region: 228-290,320-341
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.57e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012916   Gene: ENSSTOG00000014409   Transcript: ENSSTOT00000014420
Sequence length 349
Comment pep:known_by_projection scaffold:spetri2:JH393352.1:4038023:4045836:1 gene:ENSSTOG00000014409 transcript:ENSSTOT00000014420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EENGSKMKVIRVGTRKSQLARIQTDSVVAMLKALYPGLQFEIIAMSTTGDKILDTALSKI
GEKSLFTKELEYALEKNEVDLVVHSLKDLPTVLPPAFTIGAICKRENPCDAVVFHPKFVG
KTLETLPEKSTVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEQHEFSAIILAVA
GLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVGVLHDPETLLRCIAER
AFLRHLEGGCSVPVAVHTVIKDGQLYLTGGVWSLDGSDSMQETMQATIHVPTQQYDGPED
DPQLVGITALNIPRGAQLAAENLGISLASLLLNKGAKNILDVARQLNDV
Download sequence
Identical sequences ENSSTOP00000012916 ENSSTOP00000012916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]