SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013205 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013205
Domain Number 1 Region: 12-89
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.31e-27
Family Nucleoplasmin-like core domain 0.0000359
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013205
Domain Number - Region: 185-262
Classification Level Classification E-value
Superfamily HRDC-like 0.0379
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013205   Gene: ENSSTOG00000014732   Transcript: ENSSTOT00000014741
Sequence length 266
Comment pep:known_by_projection scaffold:spetri2:JH393419.1:3712962:3725505:-1 gene:ENSSTOG00000014732 transcript:ENSSTOT00000014741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTXAVEEDAESEDEEEEDVKLLSVSGKRSAPGGGSK
VPQKKVKLAADEDVDDDEDDDDDDEDDDDDDFDDEETEEKAPVKKSIRDTPAKNAQKSNQ
NGKDSKPTTPRSKSRGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKF
VNYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences ENSSTOP00000013205 ENSSTOP00000013205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]