SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013293 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013293
Domain Number 1 Region: 622-1152
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-151
Family alpha-mannosidase, C-terminal domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 119-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.5e-138
Family alpha-mannosidase 0.00000000108
Further Details:      
 
Domain Number 3 Region: 502-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.26e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013293   Gene: ENSSTOG00000014837   Transcript: ENSSTOT00000014841
Sequence length 1153
Comment pep:known_by_projection scaffold:spetri2:JH393293.1:16098998:16116209:-1 gene:ENSSTOG00000014837 transcript:ENSSTOT00000014841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPALLPYHTANGSWVVPPEPRPSFFSISPQDCQFAL
EDRGQKPELQMLTVSEELPFDNVEGGVWRQGFDISYSPHDWDTEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDSRRRFLWAEVSFFAKWWDNINAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPELHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLAVAHAR
RSGLASRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVGLKQVII
NAAHYLVLGDKDTYHFDPEAPFLQMDDTRLNHDALPERTVIQLDSSPRFVVLFNPLEQER
LSVVSLLVNSPRVRVLSEEGQPLAVQISAHWRSATDMVPDVYEVSVPIRLPALGLGVLQL
QLGLDGHRTLPSSVRVYLHGRQLSVSRHDAFPLHVIDSGSSDFALSNRYMQVWFSGLTGL
PKSIRRVDEEQDQQMNMEFLIYGTRTSKDKSGAYLFLPDGEAKPYSPKDPPVLRVTEGPF
YSEVVAYYEHVHQVVRLYNLPGVEGLSLDVSSLVDIRDYVNKELALRIHTDIDSQGTFFT
DLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLRDGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTRNCFRLLLERRTVGSESILQVQEGRSTSYPSLLSHMTS
MYLNTPVLALPVAKRQLPGSSLHSFHPLASALPCDFHLLNLRTLPGEDNLPSADTAFILH
RKGFDCSLEAKNLGFNCTTSQGKVALGSLFHGLDVGFLQPTSLTLLYPLASPSNSTDIYL
EPMEIATFRLRLG
Download sequence
Identical sequences ENSSTOP00000013293 ENSSTOP00000013293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]