SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013345 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013345
Domain Number 1 Region: 30-481
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-70
Family ALDH-like 0.000021
Further Details:      
 
Domain Number 2 Region: 495-764
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-45
Family ALDH-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013345   Gene: ENSSTOG00000014893   Transcript: ENSSTOT00000014898
Sequence length 797
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:3326570:3338892:1 gene:ENSSTOG00000014893 transcript:ENSSTOT00000014898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETRAELRAHEIFTTLEYGPVPESYACATAWLDTQDRCLGHYVNGKWLKPVHGDIVPWW
DPISGFENFPNCISHKSWVPSASGSWASMLSGVGPSPYFLPRLAKMIQKHQRLLWTLESL
ATGRAIREVRDGDVPLAQQLLQFHAVQAYTQEEALAGWEPVGVVGLILPPKFSFLEMMWR
ICPALAMGCTVVALVPLASPTPLLLAQLAGELGSFPGIINVISGPASLGPALASWPGVQK
VAFCGAIEEGRALRRTLAGEGAELGLALGTESLLLLTDSADVDSAVEGVVDAAWSDRSPG
GLRLLVQESVWDETMKRLQVRMGRLRGGQEVDGAVDMGVKEPTAYILARNYVEEARKQGA
QVFQASEMPSVSPFCPPTLITGLPPASPCAQAEVPWPLVMASAFRTAKEALAIVNGTPRG
GSASVWSERLGLALELGYGLQMGTVWINAHGLRDPAVPTGGCKESGSSWHGGLDGLYEYL
RPSGTPARVPFLCENLNYDTFGLAVPPALPAGPEMGPSPAPPYGLFVGGRFQAPGSRSSR
PIQDSSGNLHGYVAEGGAKDVRDAVEAAHQAAPGWAGQSPGARAALLWALAAALERRVPT
LASRLERQGVELKAAKAEVELSIQRLRTWGAQAQAQGHTLQVAGLRGPVLRLREPLGVLA
IVCPDELPLLAFVSLLAPALAHGNTVVLVPSGTCPLLALEVCQDMATLFPAGLVNVVTGN
RDHLTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEAEGAGPE
LALRAARTKALWLPMGD
Download sequence
Identical sequences ENSSTOP00000013345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]