SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013349 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013349
Domain Number 1 Region: 110-281
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.63e-52
Family NadC C-terminal domain-like 0.0000202
Further Details:      
 
Domain Number 2 Region: 6-109
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.46e-25
Family NadC N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013349   Gene: ENSSTOG00000014904   Transcript: ENSSTOT00000014902
Sequence length 294
Comment pep:novel scaffold:spetri2:JH393311.1:12745663:12747079:-1 gene:ENSSTOG00000014904 transcript:ENSSTOT00000014902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSLLLPPTTLAALADSWLREDCPGLNFAALVTGAAPSQAALWAKSPGVLAGRPFFDAIF
AQLNCQVTWLLPEGSQLVPVVQVAEVRGPAHRLLLGERVALNMLARCSGIASAAATAVKI
ARGTGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGMVMVKDNHVVAAGGVEKA
VRSARQAVDFTLKVEVECSSLQEAVHAAEAGADLVLLDNFKPEELHPIAQALKAQFPRVA
VEASGGVTLSNISQFCGPHIDVISLGMLTQAAPALDFSLKLFAEGATPVPHSRR
Download sequence
Identical sequences ENSSTOP00000013349 ENSSTOP00000013349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]