SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013448 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013448
Domain Number 1 Region: 29-512
Classification Level Classification E-value
Superfamily ALDH-like 2.75e-184
Family ALDH-like 0.0000000000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013448   Gene: ENSSTOG00000015009   Transcript: ENSSTOT00000015009
Sequence length 517
Comment pep:novel scaffold:spetri2:JH393368.1:4362790:4387330:1 gene:ENSSTOG00000015009 transcript:ENSSTOT00000015009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAAGLGPRLGCRLLSAAATHAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPS
TGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPMDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFLERSVARAKSRVVGNPFDSRTEQGP
QVDETQFKKILGYIQSGKQEGAKLLCGGEAAAERGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences A0A287DA48
XP_005329685.1.77405 ENSSTOP00000013448 ENSSTOP00000013448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]