SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013522 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013522
Domain Number 1 Region: 294-352
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000278
Family BSTI 0.068
Further Details:      
 
Domain Number 2 Region: 661-719
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000114
Family BSTI 0.023
Further Details:      
 
Domain Number 3 Region: 2225-2282
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000376
Family ATI-like 0.058
Further Details:      
 
Domain Number 4 Region: 760-822
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000196
Family ATI-like 0.012
Further Details:      
 
Domain Number 5 Region: 821-863
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family Fibronectin type I module 0.092
Further Details:      
 
Domain Number 6 Region: 2389-2461
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000324
Family VWC domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013522
Domain Number - Region: 345-392
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family VWC domain 0.072
Further Details:      
 
Domain Number - Region: 711-753
Classification Level Classification E-value
Superfamily FnI-like domain 0.00157
Family Fibronectin type I module 0.046
Further Details:      
 
Domain Number - Region: 1133-1189
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0152
Family BSTI 0.032
Further Details:      
 
Domain Number - Region: 1189-1225
Classification Level Classification E-value
Superfamily FnI-like domain 0.0241
Family VWC domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013522   Gene: ENSSTOG00000015078   Transcript: ENSSTOT00000015089
Sequence length 2645
Comment pep:novel scaffold:spetri2:JH393626.1:60499:89431:1 gene:ENSSTOG00000015078 transcript:ENSSTOT00000015089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRLARLVAVCLALALAGGSELQREARPRSHGHSVCSTWGDFHYKTFDGDVFRFPGLCD
YNFASDCRDSYKEFAVHLKRSQGQGGGHPQVESILLTVKDDTIYLTHQLVVVNGAMVSTP
HYSSGLLIEKNEAYTKVYSRAGLSLMWNREDALMLELDSRFQNHTCGLCGDFNGLQSYLE
FLSEAGITFSAIEFGNMQKINKPEVVCEDPEEVPAPESCSKHRAECERLLTAAAFQDCQA
RLPLEPYVQACMQDRCRCPQGGACVCSTLAEFSRQCSHAGGRPGNWRSASFCPKSCPGNM
VYLESGSPCVDTCSHLEVSSLCEEHHMDGCFCPEGTVYDDLTGSGCVPVSQCHCKLHGHL
YVPGQEITNDCEQCVCNAGRWVCKDLPCPGTCTLEGGSHITTFDGKKFTFHGDCYYVLTK
GAHNDSFTLLGELAPCGSTDKQTCLKTVALLTDRKKNVVAFKSDGSVLLNELAVTLPHVA
ASFSIFQPSSYHIVVNTALGLRLQVQLVPVMQLFVTLDQAAQGQVQGLCGDFNGLESDDF
RTAGGLVEATGSSFANSWKAQASCHDKLDWLDDPCSLNIESANYAEHWCSLLKKAETPFG
RCHLAVDPTEYYKRCKYDTCNCQNNEDCLCAALSSYARACATKGVMLWGWRERVCNKDVG
SCPKSQIFLYNLTTCQQTCRSLSEGETHCLKGFTPVDGCGCPDHTFLDEKGRCVPLAKCS
CYHRGLYLEAGDVVLRQEERCVCRNGRLHCTQVKLIGQSCAAPKILVDCNNLTALATREP
RPTSCQTLVAGYYHTDCVSGCVCPEGLLDDGRGGCVVEEECPCVHNKDLYSPGDKIKLDC
NNTCTCQRGRWQCTQFLCHGTCSIYGSGHYITFDGKHYDFDGHCSYVAVQDYCGQNSSTG
SFSIITENVPCGTTGVTCSKAIKIFIGRTELKLEDKRRQVVQLEEGHHVAYTTREVGQYL
VVEASSGIIVIWDKKTTIFIKLAPSYKGTVCGLCGNFDDRTSNDFTTRDHMVVSSELDFG
NSWKEASTCPDVSTVPDPCSLNPHRRSWAEKQCSIIKSSVFSVCHSKVDPTVFYEACVQD
SCSCDTGGDCECFCSAVASYAQECTKAEACVFWRTPDLCPIFCDYYNPPDECEWHYEPCG
NRSFETCRTINGIHSNISVSYLEGCYPRCPMDRPIYDEDLKKCVTGDKCGCYVGDTRYPP
GAQVPTKDICTSCVCTDSSHVVCHPDEGKILNKTQDGVFCYWEFCGPNGTVERHFNICVT
TTAPPSTPTSSTTSVPTTSSVPTTTTTTTTTTPFTSREPCCFWTDWINEDHPSSGSDGGD
RETFDSVCKAPEDIQCRSATEPHLSWEELGQNVHCNLSVGFICKNEDQFVTGPFELCYDY
EIRVNCCLPRWECPTSHTPRTTPPPTATPTPTTTPTTTATPTSTATPTTVTVTTTESTAT
SKATPVATSTVTPTPTPTSTGTEVPTPTGTVPTTASTASTPATSPSTPVTTQSTPSLSSE
STTLPTTPLTTKEPSSTPTSPRTTPPVATVTSGSTPGPEASTSGTTPTSPGGPPSAREPR
SPGLAWLSASGGCPGSAQEGRPWEGRGWLRVPFPLSTLPECREPRPSSVPGPRGRAPWRA
LGCVEQGLLGPPCLGLPAWASLPGPPCLGLWSLGVAEEAGGAGMLSLQPCSPSCSSAAAP
SLGLPCSPPWHTVALVSSRPATFPSGSCCRAPVAPKRSDGLSSRPVLTGTPISTTTPHTV
STTTVGTPTRTGPSTMPTTLETTLATSTPIETPSTPWETGTSTTCCVLNDTYYIPGDVVY
NNTIRDTCYYVNCSVDCELQYFNWSCPSTPTPTPTSSMPTPSSVATPLTPSTPKPSTPAT
TSSKPTPGTTKPTGCLDFDPPRQENETWWLCNCTMAICKHDNVVEIVEKECQPPPMPTCS
NGLKPVRVMDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEVTPQVDN
FGVYIDNYHCDVNDQVSCPRTLIVRHETQEVLMQTTQMMPLKVQVQVNKQAVALPYKKYG
LQVYESGISFVVDIPELGALISYNGLSFSIRLPYRLFGNNTKGQCATGTCTNSTADDCVL
PSGEITSNCEAAADQWVVNDPSKPHCPHGSFTTRRPALTTPGGSPSTLPENCTPSPLCQL
IKDSLFSQCHASVPPQHYYEACVFDSCFVPGSGLECASVQAYAALCAQQGVCVDWRDHTH
GACSVTCPSHREYRACGPPQEPTCQSSPSPQNSSSLVEGCYCPEGTMSYAPGFDVCVKTC
GCVGPDNVPREFGERFVFDCKDCVCLEGGSGIVCQPKQCSQRAPVKCEEDGTYLVTEVDP
ADTCCSISLCKCNTSLCREEPPSCPLGFQVKSRMVPGRCCPVYSCVPKGVCVHQNAEYQP
GSPVYSSKCQDCVCTHAVDNSTQLHVITCTHVPCNVSCDPGFELVEDPGQCCKKCEQTHC
IINRPKSQYLILKPGDIQSNPNNKCMFYSCMKVHNQLISSVSNISCPDFDPSRCVPGSIT
LMPNGCCQRCIPLNETRVPCATIPVIREISRAGCTKNVTMNYCSGSCGTFAMYSAQAQAL
DHRCSCCKEERTSEREVVLDCPNGGTLAHTYTHIESCLCQDSVCGLPLAGQSRVRRSSPR
LLGKA
Download sequence
Identical sequences ENSSTOP00000013522 ENSSTOP00000013522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]